TMEM30B Antikörper (Middle Region)

Produktnummer ABIN635017

Produktdetails anti-TMEM30B Antikörper

Target: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM30B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM30 B antibody was raised against the middle region of TMEM30

Aufreinigung: Affinity purified

Immunogen: TMEM30 B antibody was raised using the middle region of TMEM30 corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM30B Blocking Peptide, catalog no. 33R-9922, is also available for use as a blocking control in assays to test for specificity of this TMEM30B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM30B

Target: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Andere Bezeichnung: TMEM30B (TMEM30B Produkte)

Synonyme: CDC50B antikoerper, 9130011B11Rik antikoerper, transmembrane protein 30B antikoerper, TMEM30B antikoerper, Tmem30b antikoerper

Hintergrund: TMEM30B belongs to the CDC50/LEM3 family. It is a multi-pass membrane protein. The function of the TMEM30B protein remains unknown.

Molekulargewicht: 39 kDa (MW of target protein)