ERGIC3 Antikörper (C-Term)

Produktnummer ABIN635020

Produktdetails anti-ERGIC3 Antikörper

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERGIC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ERGIC3 antibody was raised against the C terminal of ERGIC3

Aufreinigung: Affinity purified

Immunogen: ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERGIC3 Blocking Peptide, catalog no. 33R-5472, is also available for use as a blocking control in assays to test for specificity of this ERGIC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERGIC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERGIC3

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Andere Bezeichnung: ERGIC3 (ERGIC3 Produkte)

Synonyme: sdbcag84 antikoerper, zgc:113959 antikoerper, zgc:55762 antikoerper, C20orf47 antikoerper, CGI-54 antikoerper, Erv46 antikoerper, NY-BR-84 antikoerper, PRO0989 antikoerper, SDBCAG84 antikoerper, dJ477O4.2 antikoerper, 2310015B14Rik antikoerper, AV318804 antikoerper, D2Ucla1 antikoerper, Sdbcag84 antikoerper, ERGIC and golgi 3 antikoerper, ERGIC3 antikoerper, ergic3 antikoerper, Ergic3 antikoerper

Hintergrund: ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi.

Molekulargewicht: 43 kDa (MW of target protein)