ERGIC3 Antikörper (C-Term)
-
- Target Alle ERGIC3 Antikörper anzeigen
- ERGIC3 (ERGIC and Golgi 3 (ERGIC3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERGIC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ERGIC3 antibody was raised against the C terminal of ERGIC3
- Aufreinigung
- Affinity purified
- Immunogen
- ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
- Top Product
- Discover our top product ERGIC3 Primärantikörper
-
anti-ERGIC and Golgi 3 (ERGIC3) (AA 47-341) antibody
ERGIC3 Reaktivität: Human ELISA, WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-ERGIC and Golgi 3 (ERGIC3) (AA 1-30), (N-Term) antibodyERGIC3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB22586 unconjugated
anti-ERGIC and Golgi 3 (ERGIC3) antibodyERGIC3 Reaktivität: Human, Maus ELISA, WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-ERGIC and Golgi 3 (ERGIC3) (C-Term) antibodyERGIC3 Reaktivität: Human, Maus ELISA, WB, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-ERGIC and Golgi 3 (ERGIC3) (C-Term) antibodyERGIC3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Affe WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-ERGIC and Golgi 3 (ERGIC3) (AA 1-30), (N-Term) antibodyERGIC3 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-ERGIC and Golgi 3 (ERGIC3) antibody (HRP)ERGIC3 Reaktivität: Human ELISA, WB, IHC, IF, IHC (p) Wirt: Kaninchen Polyclonal HRP
anti-ERGIC and Golgi 3 (ERGIC3) antibody (FITC)ERGIC3 Reaktivität: Human ELISA, WB, IHC, IF, IHC (p) Wirt: Kaninchen Polyclonal FITC
anti-ERGIC and Golgi 3 (ERGIC3) antibody (Biotin)ERGIC3 Reaktivität: Human ELISA, WB, IHC, IF, IHC (p) Wirt: Kaninchen Polyclonal Biotin
anti-ERGIC and Golgi 3 (ERGIC3) (C-Term) antibodyERGIC3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Affe, Hund, Pferd, Schwein, Kaninchen, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERGIC3 Blocking Peptide, catalog no. 33R-5472, is also available for use as a blocking control in assays to test for specificity of this ERGIC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERGIC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERGIC3 (ERGIC and Golgi 3 (ERGIC3))
- Andere Bezeichnung
- ERGIC3 (ERGIC3 Produkte)
- Hintergrund
- ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi.
- Molekulargewicht
- 43 kDa (MW of target protein)
-
