C16orf58 Antikörper (N-Term)

Produktnummer ABIN635025

Produktdetails anti-C16orf58 Antikörper

Target: C16orf58 (Chromosome 16 Open Reading Frame 58 (C16orf58))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C16orf58 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C16 ORF58 antibody was raised against the N terminal Of C16 rf58

Aufreinigung: Affinity purified

Immunogen: C16 ORF58 antibody was raised using the N terminal Of C16 rf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C16ORF58 Blocking Peptide, catalog no. 33R-7482, is also available for use as a blocking control in assays to test for specificity of this C16ORF58 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF58 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C16orf58

Target: C16orf58 (Chromosome 16 Open Reading Frame 58 (C16orf58))

Andere Bezeichnung: C16ORF58 (C16orf58 Produkte)

Synonyme: RUS antikoerper, chromosome 16 open reading frame 58 antikoerper, chromosome 20 open reading frame, human C16orf58 antikoerper, C16orf58 antikoerper, C20H16orf58 antikoerper, c16orf58 antikoerper

Hintergrund: The function of C16orf58 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 51 kDa (MW of target protein)