MARCO Antikörper (N-Term)

Produktnummer ABIN635028

Produktdetails anti-MARCO Antikörper

Target: MARCO (Macrophage Receptor with Collagenous Structure (MARCO))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MARCO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MARCO antibody was raised against the N terminal of MARCO

Aufreinigung: Affinity purified

Immunogen: MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MARCO Blocking Peptide, catalog no. 33R-7477, is also available for use as a blocking control in assays to test for specificity of this MARCO antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARCO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MARCO

Target: MARCO (Macrophage Receptor with Collagenous Structure (MARCO))

Andere Bezeichnung: MARCO (MARCO Produkte)

Synonyme: AI323439 antikoerper, Ly112 antikoerper, Scara2 antikoerper, SCARA2 antikoerper, macrophage receptor with collagenous structure antikoerper, MARCO antikoerper, Marco antikoerper

Hintergrund: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Activation of Innate immune Response