ACSL1 Antikörper (N-Term)

Produktnummer ABIN635029

Produktdetails anti-ACSL1 Antikörper

Target: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACSL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACSL1 antibody was raised against the N terminal of ACSL1

Aufreinigung: Affinity purified

Immunogen: ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL1 Blocking Peptide, catalog no. 33R-1349, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACSL1

Target: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Andere Bezeichnung: ACSL1 (Acsl1 Produkte)

Synonyme: ACS1 antikoerper, FACL1 antikoerper, FACL2 antikoerper, LACS antikoerper, LACS1 antikoerper, LACS2 antikoerper, Acas antikoerper, Acas1 antikoerper, Acs antikoerper, FACS antikoerper, Facl2 antikoerper, ACS antikoerper, COAA antikoerper, zgc:110081 antikoerper, CER8 antikoerper, ECERIFERUM 8 antikoerper, LONG-CHAIN ACYL-COA SYNTHASE 1 antikoerper, T8I13.8 antikoerper, F13F21.14 antikoerper, F13F21_14 antikoerper, LATERAL ROOT DEVELOPMENT 2 antikoerper, LRD2 antikoerper, long-chain acyl-CoA synthetase 2 antikoerper, acyl-CoA synthetase long chain family member 1 antikoerper, acyl-CoA synthetase long-chain family member 1 antikoerper, acyl-CoA synthetase long chain family member 1a antikoerper, AMP-dependent synthetase and ligase family protein antikoerper, long-chain acyl-CoA synthetase 2 antikoerper, ACSL1 antikoerper, Acsl1 antikoerper, acsl1a antikoerper, LACS1 antikoerper, LACS2 antikoerper

Hintergrund: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha