OLFML2B Antikörper (N-Term)

Produktnummer ABIN635031

Produktdetails anti-OLFML2B Antikörper

Target: OLFML2B (Olfactomedin-Like 2B (OLFML2B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLFML2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OLFML2 B antibody was raised against the N terminal of OLFML2

Aufreinigung: Affinity purified

Immunogen: OLFML2 B antibody was raised using the N terminal of OLFML2 corresponding to a region with amino acids EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OLFML2B Blocking Peptide, catalog no. 33R-2397, is also available for use as a blocking control in assays to test for specificity of this OLFML2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLFML2B

Target: OLFML2B (Olfactomedin-Like 2B (OLFML2B))

Andere Bezeichnung: OLFML2B (OLFML2B Produkte)

Synonyme: RP11-227F8.1 antikoerper, 1110018N05Rik antikoerper, 4832415H08Rik antikoerper, AI467542 antikoerper, olfactomedin like 2B antikoerper, olfactomedin-like 2B antikoerper, olfactomedin-like 2Bb antikoerper, OLFML2B antikoerper, Olfml2b antikoerper, olfml2bb antikoerper

Hintergrund: The function of OLFML2B protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 84 kDa (MW of target protein)