MAVS Antikörper (C-Term)
-
- Target Alle MAVS Antikörper anzeigen
- MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAVS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- VISA antibody was raised against the C terminal of VISA
- Aufreinigung
- Affinity purified
- Immunogen
- VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ
- Top Product
- Discover our top product MAVS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VISA Blocking Peptide, catalog no. 33R-9412, is also available for use as a blocking control in assays to test for specificity of this VISA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VISA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))
- Andere Bezeichnung
- VISA (MAVS Produkte)
- Synonyme
- CARDIF antikoerper, IPS-1 antikoerper, IPS1 antikoerper, VISA antikoerper, D430028G21Rik antikoerper, Visa antikoerper, cardif antikoerper, wu:fj20d04 antikoerper, zgc:158392 antikoerper, mitochondrial antiviral signaling protein antikoerper, MAVS antikoerper, Mavs antikoerper, mavs antikoerper
- Hintergrund
- Double-stranded RNA viruses are recognised in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic RNA helicases MDA5 and RIGI (ROBO3). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Inositol Metabolic Process, Hepatitis C
-