SLC25A38 Antikörper (Middle Region)
-
- Target Alle SLC25A38 Antikörper anzeigen
- SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A38 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SLC25 A38 antibody was raised against the middle region of SLC25 38
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A38 antibody was raised using the middle region of SLC25 38 corresponding to a region with amino acids VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
- Top Product
- Discover our top product SLC25A38 Primärantikörper
-
anti-Solute Carrier Family 25, Member 38 (SLC25A38) (AA 101-200) antibody
SLC25A38 Reaktivität: Maus, Ratte ELISA, WB, IF (cc), IF (p), IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 25, Member 38 (SLC25A38) antibodySLC25A38 Reaktivität: Human, Maus WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 25, Member 38 (SLC25A38) (AA 140-220) antibodySLC25A38 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 25, Member 38 (SLC25A38) (AA 101-150) antibodySLC25A38 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Kaninchen, Schaf, Hamster, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 25, Member 38 (SLC25A38) antibodySLC25A38 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 25, Member 38 (SLC25A38) (AA 1-30) antibodySLC25A38 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 25, Member 38 (SLC25A38) (Middle Region) antibodySLC25A38 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Pferd, Kaninchen, Schaf, Meerschweinchen, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A38 Blocking Peptide, catalog no. 33R-9563, is also available for use as a blocking control in assays to test for specificity of this SLC25A38 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 38 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A38 (Solute Carrier Family 25, Member 38 (SLC25A38))
- Andere Bezeichnung
- SLC25A38 (SLC25A38 Produkte)
- Synonyme
- AV019094 antikoerper, BC010801 antikoerper, RGD1311914 antikoerper, zgc:153036 antikoerper, solute carrier family 25 member 38 antikoerper, solute carrier family 25, member 38 antikoerper, solute carrier family 25 member 38 L homeolog antikoerper, solute carrier family 25, member 38a antikoerper, SLC25A38 antikoerper, Slc25a38 antikoerper, slc25a38.L antikoerper, slc25a38a antikoerper
- Hintergrund
- SLC25A38 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.
- Molekulargewicht
- 33 kDa (MW of target protein)
-
