SLC25A28 Antikörper (C-Term)
-
- Target Alle SLC25A28 Antikörper anzeigen
- SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC25 A28 antibody was raised against the C terminal of SLC25 28
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A28 antibody was raised using the C terminal of SLC25 28 corresponding to a region with amino acids NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST
- Top Product
- Discover our top product SLC25A28 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A28 Blocking Peptide, catalog no. 33R-6904, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))
- Andere Bezeichnung
- SLC25A28 (SLC25A28 Produkte)
- Hintergrund
- SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-