AFG3L2 Antikörper
-
- Target Alle AFG3L2 Antikörper anzeigen
- AFG3L2 (AFG3-Like Protein 2 (AFG3L2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AFG3L2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AFG3 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS
- Top Product
- Discover our top product AFG3L2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AFG3L2 Blocking Peptide, catalog no. 33R-9704, is also available for use as a blocking control in assays to test for specificity of this AFG3L2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFG0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AFG3L2 (AFG3-Like Protein 2 (AFG3L2))
- Andere Bezeichnung
- AFG3L2 (AFG3L2 Produkte)
- Synonyme
- MGC147390 antikoerper, si:ch211-12e1.4 antikoerper, SCA28 antikoerper, SPAX5 antikoerper, 2310036I02Rik antikoerper, AW260507 antikoerper, Emv66 antikoerper, par antikoerper, AFG3 like matrix AAA peptidase subunit 2 antikoerper, AFG3-like protein 2 antikoerper, AFG3 ATPase family gene 3-like 2 (S. cerevisiae) antikoerper, AFG3-like AAA ATPase 2 antikoerper, AFG3-like AAA ATPase 2 L homeolog antikoerper, AFG3L2 antikoerper, LOC578526 antikoerper, afg3l2 antikoerper, afg3l2.L antikoerper, Afg3l2 antikoerper
- Hintergrund
- AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.
- Molekulargewicht
- 88 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-