CEND1 Antikörper (N-Term)

Produktnummer ABIN635055

Produktdetails anti-CEND1 Antikörper

Target: CEND1 (Cell Cycle Exit and Neuronal Differentiation 1 (CEND1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CEND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CEND1 antibody was raised against the N terminal of CEND1

Aufreinigung: Affinity purified

Immunogen: CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CEND1 Blocking Peptide, catalog no. 33R-5964, is also available for use as a blocking control in assays to test for specificity of this CEND1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CEND1

Target: CEND1 (Cell Cycle Exit and Neuronal Differentiation 1 (CEND1))

Andere Bezeichnung: CEND1 (CEND1 Produkte)

Synonyme: BM88 antikoerper, 1500001H12Rik antikoerper, AI415214 antikoerper, C38 antikoerper, RGD1309401 antikoerper, cell cycle exit and neuronal differentiation 1 antikoerper, CEND1 antikoerper, Cend1 antikoerper

Hintergrund: CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.

Molekulargewicht: 15 kDa (MW of target protein)