CXorf66 Antikörper (Middle Region)
-
- Target Alle CXorf66 Antikörper anzeigen
- CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CXorf66 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- CXorf66 antibody was raised against the middle region of CXorf66
- Aufreinigung
- Affinity purified
- Immunogen
- CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE
- Top Product
- Discover our top product CXorf66 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CXorf66 Blocking Peptide, catalog no. 33R-7216, is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXorf66 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CXorf66 (Chromosome X Open Reading Frame 66 (CXorf66))
- Andere Bezeichnung
- CXorf66 (CXorf66 Produkte)
- Hintergrund
- The protein encoded by this gene is predicted to be a type I membrane protein, however, its exact function is not known.
- Molekulargewicht
- 40 kDa (MW of target protein)
-