NHEDC2 Antikörper (C-Term)

Produktnummer ABIN635063

Produktdetails anti-NHEDC2 Antikörper

Target: NHEDC2 (Na+/H+ Exchanger Domain Containing 2 (NHEDC2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NHEDC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NHEDC2 antibody was raised against the C terminal of NHEDC2

Aufreinigung: Affinity purified

Immunogen: NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NHEDC2 Blocking Peptide, catalog no. 33R-3957, is also available for use as a blocking control in assays to test for specificity of this NHEDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NHEDC2

Target: NHEDC2 (Na+/H+ Exchanger Domain Containing 2 (NHEDC2))

Andere Bezeichnung: NHEDC2 (NHEDC2 Produkte)

Synonyme: NHA2 antikoerper, NHE10 antikoerper, NHEDC2 antikoerper, C80638 antikoerper, Nhedc2 antikoerper, nha-oc antikoerper, nhaoc antikoerper, solute carrier family 9 member B2 antikoerper, solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2 antikoerper, SLC9B2 antikoerper, Slc9b2 antikoerper

Hintergrund: Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Proton Transport