SLC25A21 Antikörper

Produktnummer ABIN635065

Produktdetails anti-SLC25A21 Antikörper

Target: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A21 Blocking Peptide, catalog no. 33R-3137, is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A21

Target: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Andere Bezeichnung: SLC25A21 (Slc25a21 Produkte)

Synonyme: zgc:153387 antikoerper, ODC antikoerper, ODC1 antikoerper, Odc1 antikoerper, 9930033G19Rik antikoerper, A630030I10 antikoerper, BB158148 antikoerper, solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 antikoerper, solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 L homeolog antikoerper, solute carrier family 25 member 21 antikoerper, solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 antikoerper, slc25a21 antikoerper, slc25a21.L antikoerper, SLC25A21 antikoerper, Slc25a21 antikoerper

Hintergrund: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom