LINGO4 Antikörper (Middle Region)
-
- Target Alle LINGO4 Antikörper anzeigen
- LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LINGO4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LINGO4 antibody was raised against the middle region of LINGO4
- Aufreinigung
- Affinity purified
- Immunogen
- LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT
- Top Product
- Discover our top product LINGO4 Primärantikörper
-
anti-Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4) (AA 543-571), (C-Term) antibody
LINGO4 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB31553 unconjugated
anti-Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4) (AA 468-517) antibodyLINGO4 Reaktivität: Human, Maus, Ratte, Schwein, Kaninchen, Rind (Kuh), Hund, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4) (AA 550-579), (C-Term) antibodyLINGO4 Reaktivität: Human, Maus WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LINGO4 Blocking Peptide, catalog no. 33R-9169, is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))
- Andere Bezeichnung
- LINGO4 (LINGO4 Produkte)
- Synonyme
- A530050P17Rik antikoerper, LERN4 antikoerper, Lrrn6d antikoerper, RGD1562025 antikoerper, DAAT9248 antikoerper, LRRN6D antikoerper, PRO34002 antikoerper, zgc:198379 antikoerper, leucine rich repeat and Ig domain containing 4 antikoerper, leucine rich repeat and Ig domain containing 4b antikoerper, Lingo4 antikoerper, LINGO4 antikoerper, lingo4b antikoerper
- Hintergrund
- The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 64 kDa (MW of target protein)
-
