DHODH Antikörper (C-Term)
-
- Target Alle DHODH Antikörper anzeigen
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHODH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DHODH antibody was raised against the C terminal of DHODH
- Aufreinigung
- Affinity purified
- Immunogen
- DHODH antibody was raised using the C terminal of DHODH corresponding to a region with amino acids GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
- Top Product
- Discover our top product DHODH Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHODH Blocking Peptide, catalog no. 33R-3293, is also available for use as a blocking control in assays to test for specificity of this DHODH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHODH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHODH (Dihydroorotate Dehydrogenase (DHODH))
- Andere Bezeichnung
- DHODH (DHODH Produkte)
- Synonyme
- DHOdehase antikoerper, POADS antikoerper, URA1 antikoerper, 2810417D19Rik antikoerper, AI834883 antikoerper, DDBDRAFT_0167009 antikoerper, DDBDRAFT_0185217 antikoerper, DDB_0167009 antikoerper, DDB_0185217 antikoerper, DHOD antikoerper, DHODase antikoerper, XFHB_12025 antikoerper, dhodh antikoerper, dihydroorotate dehydrogenase (quinone) antikoerper, dihydroorotate dehydrogenase antikoerper, dihydroorotate dehydrogenase (quinone) L homeolog antikoerper, DHODH antikoerper, Dhodh antikoerper, pyrD antikoerper, pyr4 antikoerper, Mrub_0263 antikoerper, Arnit_2124 antikoerper, Trad_2703 antikoerper, Ftrac_1484 antikoerper, Ndas_0799 antikoerper, Mesil_1876 antikoerper, Slip_0841 antikoerper, Spirs_1436 antikoerper, XFHB_RS12780 antikoerper, dhodh.L antikoerper
- Hintergrund
- DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Protein targeting to Nucleus
-