SLC25A39 Antikörper (C-Term)

Produktnummer ABIN635082

Produktdetails anti-SLC25A39 Antikörper

Target: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLC25 A39 antibody was raised against the C terminal of SLC25 39

Aufreinigung: Affinity purified

Immunogen: SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A39 Blocking Peptide, catalog no. 33R-8252, is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A39

Target: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Andere Bezeichnung: SLC25A39 (SLC25A39 Produkte)

Synonyme: SLC25A39 antikoerper, zgc:63736 antikoerper, CGI69 antikoerper, 3010027G13Rik antikoerper, D11Ertd333e antikoerper, RGD1306193 antikoerper, solute carrier family 25 member 39 antikoerper, solute carrier family 25, member 39 antikoerper, solute carrier family 25 member 39 L homeolog antikoerper, slc25a39 antikoerper, SLC25A39 antikoerper, slc25a39.L antikoerper, Slc25a39 antikoerper

Hintergrund: SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Molekulargewicht: 39 kDa (MW of target protein)