SLC39A8 Antikörper
-
- Target Alle SLC39A8 Antikörper anzeigen
- SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC39A8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC39 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
- Top Product
- Discover our top product SLC39A8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC39A8 Blocking Peptide, catalog no. 33R-7635, is also available for use as a blocking control in assays to test for specificity of this SLC39A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))
- Andere Bezeichnung
- SLC39A8 (SLC39A8 Produkte)
- Synonyme
- 4933419D20Rik antikoerper, AA986696 antikoerper, BIGM103 antikoerper, Zip8 antikoerper, LZT-Hs6 antikoerper, ZIP8 antikoerper, solute carrier family 39 (metal ion transporter), member 8 antikoerper, solute carrier family 39 member 8 antikoerper, Slc39a8 antikoerper, SLC39A8 antikoerper
- Hintergrund
- This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
- Molekulargewicht
- 50 kDa (MW of target protein)
-