SLC25A22 Antikörper
-
- Target Alle SLC25A22 Antikörper anzeigen
- SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A22 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
- Top Product
- Discover our top product SLC25A22 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A22 Blocking Peptide, catalog no. 33R-9708, is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 22 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))
- Andere Bezeichnung
- SLC25A22 (SLC25A22 Produkte)
- Synonyme
- 1300006L01Rik antikoerper, AI060884 antikoerper, Gc1 antikoerper, GC1 antikoerper, RGD1307826 antikoerper, EIEE3 antikoerper, NET44 antikoerper, solute carrier family 25 (mitochondrial carrier, glutamate), member 22 antikoerper, solute carrier family 25 member 22 antikoerper, Slc25a22 antikoerper, SLC25A22 antikoerper
- Hintergrund
- The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-