SLC25A46 Antikörper (C-Term)

Produktnummer ABIN635085

Produktdetails anti-SLC25A46 Antikörper

Target: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A46 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC25 A46 antibody was raised against the C terminal of SLC25 46

Aufreinigung: Affinity purified

Immunogen: SLC25 A46 antibody was raised using the C terminal of SLC25 46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A46 Blocking Peptide, catalog no. 33R-5100, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 46 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A46

Target: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Andere Bezeichnung: SLC25A46 (SLC25A46 Produkte)

Synonyme: SLC25A46 antikoerper, MGC152354 antikoerper, zgc:92767 antikoerper, slc25a46 antikoerper, 1200007B05Rik antikoerper, AI325987 antikoerper, RGD1305072 antikoerper, solute carrier family 25 member 46 antikoerper, solute carrier family 25, member 46 antikoerper, solute carrier family 25 member 46 L homeolog antikoerper, SLC25A46 antikoerper, slc25a46 antikoerper, slc25a46.L antikoerper, Slc25a46 antikoerper

Hintergrund: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.

Molekulargewicht: 46 kDa (MW of target protein)