SLC25A35 Antikörper (N-Term)

Produktnummer ABIN635087

Produktdetails anti-SLC25A35 Antikörper

Target: SLC25A35 (Solute Carrier Family 25, Member 35 (SLC25A35))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC25 A35 antibody was raised against the N terminal of SLC25 35

Aufreinigung: Affinity purified

Immunogen: SLC25 A35 antibody was raised using the N terminal of SLC25 35 corresponding to a region with amino acids DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A35 Blocking Peptide, catalog no. 33R-1931, is also available for use as a blocking control in assays to test for specificity of this SLC25A35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A35

Target: SLC25A35 (Solute Carrier Family 25, Member 35 (SLC25A35))

Andere Bezeichnung: SLC25A35 (SLC25A35 Produkte)

Synonyme: si:ch211-268m12.5 antikoerper, 1810012H11Rik antikoerper, solute carrier family 25, member 35 antikoerper, solute carrier family 25 member 35 antikoerper, slc25a35 antikoerper, SLC25A35 antikoerper, Slc25a35 antikoerper

Hintergrund: SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Molekulargewicht: 31 kDa (MW of target protein)