COQ2 Antikörper
-
- Target Alle COQ2 Antikörper anzeigen
- COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COQ2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
- Top Product
- Discover our top product COQ2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COQ2 Blocking Peptide, catalog no. 33R-3061, is also available for use as a blocking control in assays to test for specificity of this COQ2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COQ2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))
- Andere Bezeichnung
- COQ2 (COQ2 Produkte)
- Hintergrund
- COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.
- Molekulargewicht
- 42 kDa (MW of target protein)
-