SFXN1 Antikörper (N-Term)

Produktnummer ABIN635095

Produktdetails anti-SFXN1 Antikörper

Target: SFXN1 (Sideroflexin 1 (SFXN1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFXN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Sideroflexin 1 antibody was raised against the N terminal of SFXN1

Aufreinigung: Affinity purified

Immunogen: Sideroflexin 1 antibody was raised using the N terminal of SFXN1 corresponding to a region with amino acids MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Sideroflexin 1 Blocking Peptide, catalog no. 33R-6424, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFXN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFXN1

Target: SFXN1 (Sideroflexin 1 (SFXN1))

Andere Bezeichnung: Sideroflexin 1 (SFXN1 Produkte)

Synonyme: zgc:100851 antikoerper, 2810002O05Rik antikoerper, A930015P12Rik antikoerper, f antikoerper, Sideroflexin 1 antikoerper, sideroflexin 1 antikoerper, sideroflexin 1 L homeolog antikoerper, Bm1_35025 antikoerper, sfxn1 antikoerper, sfxn1.L antikoerper, SFXN1 antikoerper, Sfxn1 antikoerper

Hintergrund: SFXN1 might be involved in the transport of a component required for iron utilization into or out of the mitochondria.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis