ANO3 Antikörper (C-Term)

Produktnummer ABIN635122

Produktdetails anti-ANO3 Antikörper

Target: ANO3 (Anoctamin 3 (ANO3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANO3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM16 C antibody was raised against the C terminal of TMEM16

Aufreinigung: Affinity purified

Immunogen: TMEM16 C antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM16C Blocking Peptide, catalog no. 33R-1181, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANO3

Target: ANO3 (Anoctamin 3 (ANO3))

Andere Bezeichnung: TMEM16C (ANO3 Produkte)

Synonyme: TMEM16C antikoerper, anoctamin-3 antikoerper, C11orf25 antikoerper, DYT23 antikoerper, DYT24 antikoerper, AI838058 antikoerper, B230324K02Rik antikoerper, Tmem16c antikoerper, anoctamin 3 antikoerper, anoctamin-3 antikoerper, ANO3 antikoerper, LOC100453980 antikoerper, ano3 antikoerper, Ano3 antikoerper

Hintergrund: TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.

Molekulargewicht: 115 kDa (MW of target protein)