BACE2 Antikörper (Middle Region)
-
- Target Alle BACE2 Antikörper anzeigen
- BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BACE2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BACE2 antibody was raised against the middle region of BACE2
- Aufreinigung
- Affinity purified
- Immunogen
- BACE2 antibody was raised using the middle region of BACE2 corresponding to a region with amino acids SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
- Top Product
- Discover our top product BACE2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BACE2 Blocking Peptide, catalog no. 33R-8612, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))
- Andere Bezeichnung
- BACE2 (BACE2 Produkte)
- Synonyme
- AEPLC antikoerper, ALP56 antikoerper, ASP1 antikoerper, ASP21 antikoerper, BAE2 antikoerper, CEAP1 antikoerper, DRAP antikoerper, 1110059C24Rik antikoerper, AI850424 antikoerper, ARP1 antikoerper, CDA13 antikoerper, beta-site APP-cleaving enzyme 2 antikoerper, BACE2 antikoerper, Bace2 antikoerper
- Hintergrund
- Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
- Molekulargewicht
- 37 kDa (MW of target protein)
-