GPR177/WLS Antikörper (N-Term)

Produktnummer ABIN635133

Produktdetails anti-GPR177/WLS Antikörper

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPR177/WLS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: GPR177 antibody was raised against the N terminal of GPR177

Aufreinigung: Affinity purified

Immunogen: GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPR177 Blocking Peptide, catalog no. 33R-1477, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPR177/WLS

Target: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Andere Bezeichnung: GPR177 (WLS Produkte)

Hintergrund: GPR177 is a receptor for Wnt proteins in Wnt-secreting cells.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: WNT Signalweg