Anoctamin 6 Antikörper (Middle Region)
-
- Target Alle Anoctamin 6 (ANO6) Antikörper anzeigen
- Anoctamin 6 (ANO6)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Anoctamin 6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Anoctamin 6 antibody was raised against the middle region of ANO6
- Aufreinigung
- Affinity purified
- Immunogen
- Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
- Top Product
- Discover our top product ANO6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Anoctamin 6 Blocking Peptide, catalog no. 33R-4651, is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Anoctamin 6 (ANO6)
- Andere Bezeichnung
- Anoctamin 6 (ANO6 Produkte)
- Synonyme
- TMEM16F antikoerper, 2900059G15Rik antikoerper, AA407480 antikoerper, AW554778 antikoerper, F730003B03Rik antikoerper, Tmem16f antikoerper, BDPLT7 antikoerper, SCTS antikoerper, anoctamin 6 antikoerper, ANO6 antikoerper, ano6 antikoerper, Ano6 antikoerper
- Hintergrund
- TMEM16F may act as a calcium-activated chloride channel.
- Molekulargewicht
- 106 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-