SLCO1A2 Antikörper (Middle Region)
-
- Target Alle SLCO1A2 Antikörper anzeigen
- SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLCO1A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLCO1 A2 antibody was raised against the middle region of SLCO1 2
- Aufreinigung
- Affinity purified
- Immunogen
- SLCO1 A2 antibody was raised using the middle region of SLCO1 2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC
- Top Product
- Discover our top product SLCO1A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLCO1A2 Blocking Peptide, catalog no. 33R-1268, is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))
- Andere Bezeichnung
- SLCO1A2 (SLCO1A2 Produkte)
- Synonyme
- OATP antikoerper, OATP-A antikoerper, OATP1A2 antikoerper, SLC21A3 antikoerper, Oatp2 antikoerper, Slc21a5 antikoerper, Slco1a4 antikoerper, solute carrier organic anion transporter family member 1A2 antikoerper, solute carrier organic anion transporter family, member 1A2 antikoerper, SLCO1A2 antikoerper, Slco1a2 antikoerper
- Hintergrund
- SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.
- Molekulargewicht
- 64 kDa (MW of target protein)
-