Synaptophysin Antikörper (N-Term)
-
- Target Alle Synaptophysin (SYP) Antikörper anzeigen
- Synaptophysin (SYP)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Synaptophysin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Synaptophysin antibody was raised against the N terminal of SYP
- Aufreinigung
- Affinity purified
- Immunogen
- Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
- Top Product
- Discover our top product SYP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Synaptophysin (SYP)
- Andere Bezeichnung
- Synaptophysin (SYP Produkte)
- Synonyme
- syp-B antikoerper, xsypii antikoerper, MGC86267 antikoerper, MRXSYP antikoerper, A230093K24Rik antikoerper, AI848995 antikoerper, Syn antikoerper, p38 antikoerper, Syp1 antikoerper, mrxsyp antikoerper, syp antikoerper, xsypi antikoerper, synaptophysin S homeolog antikoerper, synaptophysin antikoerper, synaptophysin L homeolog antikoerper, synaptophysin a antikoerper, syp.S antikoerper, SYP antikoerper, syp antikoerper, Syp antikoerper, syp.L antikoerper, sypa antikoerper
- Hintergrund
- Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity
-