Acsl3 Antikörper (N-Term)

Produktnummer ABIN635143

Produktdetails anti-Acsl3 Antikörper

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Acsl3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACSL3 antibody was raised against the N terminal of ACSL3

Aufreinigung: Affinity purified

Immunogen: ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL3 Blocking Peptide, catalog no. 33R-4845, is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Acsl3

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Andere Bezeichnung: ACSL3 (Acsl3 Produkte)

Synonyme: ACSL3 antikoerper, acsl3 antikoerper, fa07a08 antikoerper, im:7155129 antikoerper, si:dkey-20f20.5 antikoerper, wu:fa07a08 antikoerper, wu:fb34c03 antikoerper, si:dkeyp-109h9.2 antikoerper, ACS3 antikoerper, FACL3 antikoerper, PRO2194 antikoerper, 2610510B12Rik antikoerper, Acs3 antikoerper, C85929 antikoerper, Facl3 antikoerper, Pro2194 antikoerper, F15H21.7 antikoerper, F15H21_7 antikoerper, long-chain acyl-CoA synthetase 3 antikoerper, acyl-CoA synthetase long-chain family member 3 antikoerper, acyl-CoA synthetase long chain family member 3 antikoerper, acyl-CoA synthetase long chain family member 3b antikoerper, acyl-CoA synthetase long chain family member 3a antikoerper, AcsL3 antikoerper, AMP-dependent synthetase and ligase family protein antikoerper, ACSL3 antikoerper, acsl3b antikoerper, acsl3a antikoerper, acsL3 antikoerper, acsl3 antikoerper, Acsl3 antikoerper, LACS3 antikoerper

Hintergrund: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom