UNC50 Antikörper
-
- Target Alle UNC50 Produkte
- UNC50 (Unc-50 Homolog (UNC50))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UNC50 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW
-
anti-Unc-50 Homolog (UNC50) (AA 5-33), (N-Term) antibody
UNC50 Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB26476 unconjugated
anti-Unc-50 Homolog (UNC50) (AA 1-100) antibodyUNC50 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Unc-50 Homolog (UNC50) (N-Term) antibodyUNC50 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Unc-50 Homolog (UNC50) (N-Term) antibodyUNC50 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Unc-50 Homolog (UNC50) antibodyUNC50 Reaktivität: Human, Maus, Ratte ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UNC50 Blocking Peptide, catalog no. 33R-5291, is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UNC50 (Unc-50 Homolog (UNC50))
- Andere Bezeichnung
- UNC50 (UNC50 Produkte)
- Hintergrund
- UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.
- Molekulargewicht
- 30 kDa (MW of target protein)
-
