UNC50 Antikörper

Produktnummer ABIN635144

Produktdetails anti-UNC50 Antikörper

Target: UNC50 (Unc-50 Homolog (UNC50))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UNC50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC50 Blocking Peptide, catalog no. 33R-5291, is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UNC50

Target: UNC50 (Unc-50 Homolog (UNC50))

Andere Bezeichnung: UNC50 (UNC50 Produkte)

Synonyme: GMH1 antikoerper, UNCL antikoerper, URP antikoerper, 1110002A21Rik antikoerper, Uncl antikoerper, zgc:56114 antikoerper, gmh1 antikoerper, unc50 antikoerper, uncl antikoerper, urp antikoerper, unc-50 inner nuclear membrane RNA binding protein antikoerper, unc-50 homolog (C. elegans) antikoerper, protein unc-50 homolog antikoerper, unc-50 homolog L homeolog antikoerper, unc-50 homolog S homeolog antikoerper, UNC50 antikoerper, Unc50 antikoerper, unc50 antikoerper, LOC550684 antikoerper, LOC100161482 antikoerper, unc50.L antikoerper, unc50.S antikoerper

Hintergrund: UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.

Molekulargewicht: 30 kDa (MW of target protein)