TMEM206 Antikörper (N-Term)

Produktnummer ABIN635147

Produktdetails anti-TMEM206 Antikörper

Target: TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))

Bindungsspezifität: N-Term

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM206 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF75 antibody was raised against the N terminal Of C1 rf75

Aufreinigung: Affinity purified

Immunogen: C1 ORF75 antibody was raised using the N terminal Of C1 rf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF75 Blocking Peptide, catalog no. 33R-3958, is also available for use as a blocking control in assays to test for specificity of this C1ORF75 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM206

Target: TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))

Andere Bezeichnung: C1ORF75 (C1orf75 Produkte)

Synonyme: C1orf75 antikoerper, RP11-384C4.5 antikoerper, 2310028N02Rik antikoerper, AI118576 antikoerper, RGD1359339 antikoerper, C16H1orf75 antikoerper, transmembrane protein 206 antikoerper, transmembrane protein 206 L homeolog antikoerper, TMEM206 antikoerper, Tmem206 antikoerper, tmem206.L antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 40 kDa (MW of target protein)