LRRC4C Antikörper (N-Term)

Produktnummer ABIN635150

Produktdetails anti-LRRC4C Antikörper

Target: LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC4C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC4 C antibody was raised against the N terminal of LRRC4

Aufreinigung: Affinity purified

Immunogen: LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC4C Blocking Peptide, catalog no. 33R-5546, is also available for use as a blocking control in assays to test for specificity of this LRRC4C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC4C

Target: LRRC4C (Leucine Rich Repeat Containing 4C (LRRC4C))

Andere Bezeichnung: LRRC4C (LRRC4C Produkte)

Synonyme: 6430556C10Rik antikoerper, NGL-1 antikoerper, mKIAA1580 antikoerper, RGD1311013 antikoerper, fd12d10 antikoerper, wu:fd12d10 antikoerper, zgc:110565 antikoerper, NGL1 antikoerper, leucine rich repeat containing 4C antikoerper, Lrrc4c antikoerper, lrrc4c antikoerper, LRRC4C antikoerper

Hintergrund: NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Synaptic Membrane