CISD2 Antikörper (N-Term)

Produktnummer ABIN635156

Produktdetails anti-CISD2 Antikörper

Target: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CISD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CISD2 antibody was raised against the N terminal of CISD2

Aufreinigung: Affinity purified

Immunogen: CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CISD2

Target: CISD2 (CDGSH Iron Sulfur Domain 2 (CISD2))

Andere Bezeichnung: CISD2 (CISD2 Produkte)

Synonyme: ERIS antikoerper, Miner1 antikoerper, NAF-1 antikoerper, WFS2 antikoerper, ZCD2 antikoerper, 1500009M05Rik antikoerper, 1500026J14Rik antikoerper, 1500031D15Rik antikoerper, AI848398 antikoerper, B630006A20Rik antikoerper, Noxp70 antikoerper, Zcd2 antikoerper, RGD1566242 antikoerper, zgc:64148 antikoerper, eris antikoerper, miner1 antikoerper, wfs2 antikoerper, zcd2 antikoerper, cisd2 antikoerper, BcDNA:RE49709 antikoerper, Dmel\\CG1458 antikoerper, CDGSH iron sulfur domain 2 antikoerper, CDGSH iron sulfur domain 2 L homeolog antikoerper, CDGSH iron sulfur domain 2 S homeolog antikoerper, CISD2 antikoerper, Cisd2 antikoerper, cisd2 antikoerper, cisd2.L antikoerper, cisd2.S antikoerper

Hintergrund: CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Activation of Innate immune Response