PORCN Antikörper

Produktnummer ABIN635157

Produktdetails anti-PORCN Antikörper

Target: PORCN (Porcupine Homolog (PORCN))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PORCN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PORCN antibody was raised using a synthetic peptide corresponding to a region with amino acids ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PORCN Blocking Peptide, catalog no. 33R-1079, is also available for use as a blocking control in assays to test for specificity of this PORCN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PORCN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PORCN

Target: PORCN (Porcupine Homolog (PORCN))

Andere Bezeichnung: PORCN (PORCN Produkte)

Hintergrund: PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Molekulargewicht: 51 kDa (MW of target protein)