UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18) (Middle Region) Antikörper

Produktnummer ABIN635162

Produktdetails

Target: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GALNTL4 antibody was raised against the middle region of GALNTL4

Aufreinigung: Affinity purified

Immunogen: GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNTL4 Blocking Peptide, catalog no. 33R-3993, is also available for use as a blocking control in assays to test for specificity of this GALNTL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNTL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 18 (GALNT18)

Andere Bezeichnung: GALNTL4 (GALNT18 Produkte)

Synonyme: GALNACT18 antikoerper, GALNT15 antikoerper, GALNTL4 antikoerper, GalNAc-T15 antikoerper, GalNAc-T18 antikoerper, 2900011G21Rik antikoerper, BC024988 antikoerper, Galntl4 antikoerper, RGD1309623 antikoerper, galntl4a antikoerper, zgc:194153 antikoerper, polypeptide N-acetylgalactosaminyltransferase 18 antikoerper, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 18a antikoerper, GALNT18 antikoerper, Galnt18 antikoerper, galnt18a antikoerper

Hintergrund: GALNTL4 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.

Molekulargewicht: 69 kDa (MW of target protein)