SLC37A3 Antikörper

Produktnummer ABIN635164

Produktdetails anti-SLC37A3 Antikörper

Target: SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC37A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: SLC37 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC37A3 Blocking Peptide, catalog no. 33R-2888, is also available for use as a blocking control in assays to test for specificity of this SLC37A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC37A3

Target: SLC37A3 (Solute Carrier Family 37 (Glycerol-3-Phosphate Transporter), Member 3 (SLC37A3))

Andere Bezeichnung: SLC37A3 (SLC37A3 Produkte)

Synonyme: 2610507O21Rik antikoerper, AU044904 antikoerper, solute carrier family 37 member 3 antikoerper, solute carrier family 37 (glycerol-3-phosphate transporter), member 3 antikoerper, solute carrier family 37, member 3 antikoerper, SLC37A3 antikoerper, Slc37a3 antikoerper

Hintergrund: SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.

Molekulargewicht: 54 kDa (MW of target protein)