SLC3A1 Antikörper (N-Term)

Produktnummer ABIN635179

Produktdetails anti-SLC3A1 Antikörper

Target: SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC3A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC3 A1 antibody was raised against the N terminal of SLC3 1

Aufreinigung: Affinity purified

Immunogen: SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC3A1

Target: SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))

Andere Bezeichnung: SLC3A1 (SLC3A1 Produkte)

Synonyme: D2H antikoerper, NBAT antikoerper, NTAA antikoerper, RBAT antikoerper, SLC3A1 antikoerper, MGC131051 antikoerper, ATR1 antikoerper, CSNU1 antikoerper, solute carrier family 3, member 1 antikoerper, solute carrier family 3 member 1 antikoerper, solute carrier family 3 (amino acid transporter heavy chain), member 1 L homeolog antikoerper, solute carrier family 3 (amino acid transporter heavy chain), member 1 antikoerper, Slc3a1 antikoerper, SLC3A1 antikoerper, slc3a1.L antikoerper, slc3a1 antikoerper

Hintergrund: This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.

Molekulargewicht: 79 kDa (MW of target protein)