SLC3A1 Antikörper (N-Term)
-
- Target Alle SLC3A1 Antikörper anzeigen
- SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC3A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC3 A1 antibody was raised against the N terminal of SLC3 1
- Aufreinigung
- Affinity purified
- Immunogen
- SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT
- Top Product
- Discover our top product SLC3A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC3A1 (Solute Carrier Family 3 Member 1 (SLC3A1))
- Andere Bezeichnung
- SLC3A1 (SLC3A1 Produkte)
- Hintergrund
- This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.
- Molekulargewicht
- 79 kDa (MW of target protein)
-