PEX11A Antikörper (Middle Region)
-
- Target Alle PEX11A Antikörper anzeigen
- PEX11A (Peroxisomal Biogenesis Factor 11 alpha (PEX11A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEX11A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEX11 A antibody was raised against the middle region of PEX11
- Aufreinigung
- Affinity purified
- Immunogen
- PEX11 A antibody was raised using the middle region of PEX11 corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL
- Top Product
- Discover our top product PEX11A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEX11A Blocking Peptide, catalog no. 33R-6165, is also available for use as a blocking control in assays to test for specificity of this PEX11A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX11A (Peroxisomal Biogenesis Factor 11 alpha (PEX11A))
- Andere Bezeichnung
- PEX11A (PEX11A Produkte)
- Synonyme
- PEX11-ALPHA antikoerper, PMP28 antikoerper, hsPEX11p antikoerper, PEX11alpha antikoerper, Pmp26p antikoerper, T2E6.18 antikoerper, T2E6_18 antikoerper, peroxin 11A antikoerper, peroxisomal biogenesis factor 11 alpha antikoerper, peroxin 11A antikoerper, PEX11A antikoerper, Pex11a antikoerper
- Hintergrund
- PEX11A belongs to the peroxin-11 family. It may be involved in peroxisomal proliferation and may regulate peroxisomes division. PEX11A may mediate binding of coatomer proteins to the peroxisomal membrane.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha, Brown Fat Cell Differentiation
-