Calsyntenin 3 Antikörper (N-Term)
-
- Target Alle Calsyntenin 3 (CLSTN3) Antikörper anzeigen
- Calsyntenin 3 (CLSTN3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calsyntenin 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calsyntenin 3 antibody was raised against the N terminal of CLSTN3
- Aufreinigung
- Affinity purified
- Immunogen
- Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
- Top Product
- Discover our top product CLSTN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calsyntenin 3 (CLSTN3)
- Andere Bezeichnung
- Calsyntenin 3 (CLSTN3 Produkte)
- Synonyme
- cstn3 antikoerper, cdhr14 antikoerper, alcbeta antikoerper, MGC84020 antikoerper, CDHR14 antikoerper, CSTN3 antikoerper, Cs3 antikoerper, Cst-3 antikoerper, mKIAA0726 antikoerper, Cstn3 antikoerper, calsyntenin 3 antikoerper, calsyntenin 3 S homeolog antikoerper, CLSTN3 antikoerper, clstn3.S antikoerper, Clstn3 antikoerper
- Hintergrund
- CLSTN3 may modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP,CLSTN3 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
- Molekulargewicht
- 106 kDa (MW of target protein)
-