LPPR5 Antikörper (N-Term)

Produktnummer ABIN635195

Produktdetails anti-LPPR5 Antikörper

Target: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LPPR5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PAP2 D antibody was raised against the N terminal of PAP2

Aufreinigung: Affinity purified

Immunogen: PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LPPR5

Target: LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))

Andere Bezeichnung: PAP2D (LPPR5 Produkte)

Synonyme: PAP2 antikoerper, PAP2D antikoerper, PRG5 antikoerper, Lppr5 antikoerper, PRG-5 antikoerper, Pap2d antikoerper, RGD1309567 antikoerper, LPPR5 antikoerper, lppr5b antikoerper, zgc:165526 antikoerper, phospholipid phosphatase related 5 antikoerper, phospholipid phosphatase related 5 L homeolog antikoerper, phospholipid phosphatase related 5b antikoerper, PLPPR5 antikoerper, Plppr5 antikoerper, plppr5.L antikoerper, plppr5b antikoerper

Hintergrund: PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Molekulargewicht: 35 kDa (MW of target protein)