KREMEN1 Antikörper (N-Term)

Produktnummer ABIN635197

Produktdetails anti-KREMEN1 Antikörper

Target: KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KREMEN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KREMEN1 antibody was raised against the N terminal of KREMEN1

Aufreinigung: Affinity purified

Immunogen: KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids WKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KREMEN1 Blocking Peptide, catalog no. 33R-9967, is also available for use as a blocking control in assays to test for specificity of this KREMEN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KREMEN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KREMEN1

Target: KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))

Andere Bezeichnung: KREMEN1 (KREMEN1 Produkte)

Synonyme: KREMEN1 antikoerper, krm1 antikoerper, kremen antikoerper, kremem1 antikoerper, KREMEN antikoerper, KRM1 antikoerper, AV002070 antikoerper, Kremen antikoerper, Krm1 antikoerper, si:ct737139.1 antikoerper, si:dkeyp-7c9.1 antikoerper, kringle containing transmembrane protein 1 antikoerper, kringle containing transmembrane protein 1 S homeolog antikoerper, KREMEN1 antikoerper, kremen1 antikoerper, Kremen1 antikoerper, kremen1.S antikoerper

Hintergrund: KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: WNT Signalweg