MPZL1 Antikörper (Middle Region)
-
- Target Alle MPZL1 Antikörper anzeigen
- MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPZL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MPZL1 antibody was raised against the middle region of MPZL1
- Aufreinigung
- Affinity purified
- Immunogen
- MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE
- Top Product
- Discover our top product MPZL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPZL1 Blocking Peptide, catalog no. 33R-4168, is also available for use as a blocking control in assays to test for specificity of this MPZL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))
- Andere Bezeichnung
- MPZL1 (MPZL1 Produkte)
- Synonyme
- MPZL1 antikoerper, MPZL1b antikoerper, PZR antikoerper, PZR1b antikoerper, PZRa antikoerper, PZRb antikoerper, 1110007A10Rik antikoerper, myelin protein zero like 1 antikoerper, myelin protein zero-like 1 antikoerper, MPZL1 antikoerper, Mpzl1 antikoerper
- Hintergrund
- MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2.
- Molekulargewicht
- 23 kDa (MW of target protein)
-