GCS1 Antikörper (N-Term)

Produktnummer ABIN635202

Produktdetails anti-GCS1 Antikörper

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GCS1 antibody was raised against the N terminal of GCS1

Aufreinigung: Affinity purified

Immunogen: GCS1 antibody was raised using the N terminal of GCS1 corresponding to a region with amino acids GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCS1 Blocking Peptide, catalog no. 33R-3486, is also available for use as a blocking control in assays to test for specificity of this GCS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCS1

Target: GCS1 (MOGS) (Mannosyl-Oligosaccharide Glucosidase (MOGS))

Andere Bezeichnung: GCS1 (MOGS Produkte)

Synonyme: Afu6g04210 antikoerper, AO090701000141 antikoerper, Mogs antikoerper, CDG2B antikoerper, CWH41 antikoerper, DER7 antikoerper, GCS1 antikoerper, 1810017N02Rik antikoerper, AI181835 antikoerper, Gcs1 antikoerper, gcs1 antikoerper, im:7160827 antikoerper, wu:fe50a12 antikoerper, wu:fk09a10 antikoerper, zgc:158312 antikoerper, mannosyl-oligosaccharide glucosidase antikoerper, mannosyl-oligosaccharide glucosidase GCS1 antikoerper, mannosyl-oligosaccharide glucosidase L homeolog antikoerper, mannosyl oligosaccharide glucosidase antikoerper, glucosidase 1 antikoerper, AFUA_6G04210 antikoerper, Tc00.1047053511015.10 antikoerper, Tc00.1047053511805.10 antikoerper, LOC5576381 antikoerper, AOR_1_260114 antikoerper, MGYG_00305 antikoerper, TERG_01248 antikoerper, mogs.L antikoerper, TTHERM_00636930 antikoerper, LOAG_03690 antikoerper, Gcs1 antikoerper, MOGS antikoerper, Mogs antikoerper, mogs antikoerper

Hintergrund: GCS1 is the first enzyme in the N-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the Glc(3)-Man(9)-GlcNAc(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom