HERPUD2 Antikörper (N-Term)

Produktnummer ABIN635204

Produktdetails anti-HERPUD2 Antikörper

Target: HERPUD2 (HERPUD Family Member 2 (HERPUD2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HERPUD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HERPUD2 antibody was raised against the N terminal of HERPUD2

Aufreinigung: Affinity purified

Immunogen: HERPUD2 antibody was raised using the N terminal of HERPUD2 corresponding to a region with amino acids MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HERPUD2 Blocking Peptide, catalog no. 33R-5864, is also available for use as a blocking control in assays to test for specificity of this HERPUD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERPUD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HERPUD2

Target: HERPUD2 (HERPUD Family Member 2 (HERPUD2))

Andere Bezeichnung: HERPUD2 (HERPUD2 Produkte)

Synonyme: zgc:56020 antikoerper, zgc:76968 antikoerper, 5031400M07Rik antikoerper, AB041580 antikoerper, RGD1307343 antikoerper, HERPUD family member 2 antikoerper, HERPUD family member 2 L homeolog antikoerper, herpud2 antikoerper, HERPUD2 antikoerper, Herpud2 antikoerper, herpud2.L antikoerper

Hintergrund: HERPUD2 could be involved in the unfolded protein response (UPR) pathway.

Molekulargewicht: 45 kDa (MW of target protein)