RHBDF1 Antikörper

Produktnummer ABIN635205

Produktdetails anti-RHBDF1 Antikörper

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHBDF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHBDF1 Blocking Peptide, catalog no. 33R-4310, is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHBDF1

Target: RHBDF1 (Rhomboid 5 Homolog 1 (RHBDF1))

Andere Bezeichnung: RHBDF1 (RHBDF1 Produkte)

Synonyme: zgc:91984 antikoerper, C16orf8 antikoerper, Dist1 antikoerper, EGFR-RS antikoerper, gene-89 antikoerper, gene-90 antikoerper, hDist1 antikoerper, C16ORF8 antikoerper, Dist antikoerper, Egfr-rs antikoerper, mKIAA4242 antikoerper, rhomboid 5 homolog 1 antikoerper, rhomboid 5 homolog 1a (Drosophila) antikoerper, RHBDF1 antikoerper, rhbdf1 antikoerper, rhbdf1a antikoerper, Rhbdf1 antikoerper

Hintergrund: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Molekulargewicht: 97 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Growth Factor Binding