LPCAT1 Antikörper (Middle Region)
-
- Target Alle LPCAT1 Antikörper anzeigen
- LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LPCAT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LPCAT1 antibody was raised against the middle region of LPCAT1
- Aufreinigung
- Affinity purified
- Immunogen
- LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF
- Top Product
- Discover our top product LPCAT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LPCAT1 Blocking Peptide, catalog no. 33R-5370, is also available for use as a blocking control in assays to test for specificity of this LPCAT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPCAT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LPCAT1 (Lysophosphatidylcholine Acyltransferase 1 (LPCAT1))
- Andere Bezeichnung
- LPCAT1 (LPCAT1 Produkte)
- Synonyme
- AYTL2 antikoerper, Aytl2 antikoerper, RGD1311599 antikoerper, PFAAP3 antikoerper, lpcat antikoerper, si:dkey-261i16.4 antikoerper, zgc:158232 antikoerper, 2900035H07Rik antikoerper, BB137372 antikoerper, BC005662 antikoerper, C87117 antikoerper, LPCAT antikoerper, rd11 antikoerper, lysophosphatidylcholine acyltransferase 1 antikoerper, LPCAT1 antikoerper, Lpcat1 antikoerper, lpcat1 antikoerper
- Hintergrund
- Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.
- Molekulargewicht
- 59 kDa (MW of target protein)
-