INSIG1 Antikörper (Middle Region)
-
- Target Alle INSIG1 Antikörper anzeigen
- INSIG1 (Insulin Induced Gene 1 (INSIG1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser INSIG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- INSIG1 antibody was raised against the middle region of INSIG1
- Aufreinigung
- Affinity purified
- Immunogen
- INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR
- Top Product
- Discover our top product INSIG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
INSIG1 Blocking Peptide, catalog no. 33R-4178, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- INSIG1 (Insulin Induced Gene 1 (INSIG1))
- Andere Bezeichnung
- INSIG1 (INSIG1 Produkte)
- Synonyme
- cl-6 antikoerper, cl6 antikoerper, CL-6 antikoerper, CL6 antikoerper, fb55a03 antikoerper, fi35b10 antikoerper, wu:fb55a03 antikoerper, wu:fi35b10 antikoerper, zgc:55439 antikoerper, 1810013C12Rik antikoerper, Insig-1 antikoerper, INSIG-1 antikoerper, insulin induced gene 1 antikoerper, insulin induced gene 1 L homeolog antikoerper, INSIG1 antikoerper, insig1 antikoerper, insig1.L antikoerper, Insig1 antikoerper
- Hintergrund
- Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-