LASS1 Antikörper (Middle Region)

Produktnummer ABIN635214

Produktdetails anti-LASS1 Antikörper

Target: LASS1 (CERS1) (Ceramide Synthase 1 (CERS1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LASS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LASS1 antibody was raised against the middle region of LASS1

Aufreinigung: Affinity purified

Immunogen: LASS1 antibody was raised using the middle region of LASS1 corresponding to a region with amino acids LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LASS1 Blocking Peptide, catalog no. 33R-5564, is also available for use as a blocking control in assays to test for specificity of this LASS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LASS1

Target: LASS1 (CERS1) (Ceramide Synthase 1 (CERS1))

Andere Bezeichnung: LASS1 (CERS1 Produkte)

Synonyme: LAG1 antikoerper, LASS1 antikoerper, UOG1 antikoerper, Lass1 antikoerper, Uog-1 antikoerper, to antikoerper, LAG1 HOMOLOG 1 antikoerper, LONGEVITY ASSURANCE GENE 1 antikoerper, ceramide synthase 1 antikoerper, TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein antikoerper, CERS1 antikoerper, Cers1 antikoerper, LAG1 antikoerper

Hintergrund: This gene encodes a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily.

Molekulargewicht: 39 kDa (MW of target protein)