TMEM93 Antikörper (N-Term)

Produktnummer ABIN635215

Produktdetails anti-TMEM93 Antikörper

Target: TMEM93 (Transmembrane Protein 93 (TMEM93))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM93 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM93 antibody was raised against the N terminal of TMEM93

Aufreinigung: Affinity purified

Immunogen: TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM93 Blocking Peptide, catalog no. 33R-1062, is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM93 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM93

Target: TMEM93 (Transmembrane Protein 93 (TMEM93))

Andere Bezeichnung: TMEM93 (TMEM93 Produkte)

Synonyme: tmem93 antikoerper, wu:fb02d05 antikoerper, zgc:56250 antikoerper, zgc:77320 antikoerper, TMEM93 antikoerper, 0610009E20Rik antikoerper, 0610025L18Rik antikoerper, Tmem93 antikoerper, RGD1309231 antikoerper, emc6 antikoerper, transmembrane protein 93 antikoerper, ER membrane protein complex subunit 6 antikoerper, ER membrane protein complex subunit 6 S homeolog antikoerper, CpipJ_CPIJ006367 antikoerper, CpipJ_CPIJ008001 antikoerper, Tsp_06149 antikoerper, EMC6 antikoerper, emc6 antikoerper, TMEM93 antikoerper, Emc6 antikoerper, emc6.S antikoerper

Hintergrund: TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

Molekulargewicht: 12 kDa (MW of target protein)